Products
Products
Suppliers
News
Search
All Categories
Products or Suppliers
Content Hub
Product Zone
Sponsorship & Membership
CPHI & PMEC China
Correctives Colorant Filtration separation Intelligent Logistics Cold chain Technical &Materials Logistics Equipment &Materials Storage Equipment &Materials Logistic Services Third-party logistics Dangerous Goods Logistics Level instrument Pressure gauge Thermometers Flow meter Gas analysis instrument Liquid analysis instrument Fermenter Equipment Other Measuring Instrument Other Logistics Medical Aesthetic Consumables Sera and Vaccines Soft tube/Hard tube Pharmaceutical Intermediates Anti-tumor Preparations Pharmaceutical Manufacturing Outsourcing Chemical and Biochemical Reactors Mixing Equipment CIP System(Clean in place) Herbal medicine Concentration Equipment Purification Equipment Low Temperature Refrigeration Seals Laboratory General Equipment Functional Food Raw Materials Inner packaging equipment Polluted Water / Wastewater Treatment Equipment Injection Raw Materials and Ingredients IVD (In Vitro Diagnostics) Consumables Suspending Agents / Thickening Agents Concentrator Equipment MES System APIs for Anti-Infective Drugs Biochemical APIs Botanical products Pharma Packaging Materials Diluents (Fillers) Intermediates for Agrochemicals Reagent Cardiovascular, Cerebrovascular, and Circulatory System Formulations Pharmaceutical R&D Outsourcing Drying Equipment TCM Pulverizer Water Purification Equipment Purification Test Instrument Air Conditioner ‌Sanitary Fittings Analytical Instrument Other Dipstick Consumables Nutraceutical Ingredients Granules Machinery Outer packaging Waste Gas Treatment Equipment Active Ingredients Binders Solubilizers Drug delivery systems Sensors APIs for Nervous System Drugs Animal-derived products Endocrine and Metabolic Preparations Disintegrants service Crystalling Equipment Pill Making Equipment Other Water Treatment Equipment Clean Clothes/Clean Cap/Clean Shoes Cold Storage Pumps Food & Beverage Raw Materials Life Science Instrument Tablet equipment Other pharmaceutical packaging equipment Solid and Hazardous Waste Treatment Equipment Innovative Materials Controllers & Drivers Speciality Intermediates Microbial products Humectants APIs for Digestive System Drugs APIs for Cardiovascular System Drugs Antibacterial and Antiviral Formulations Lubricants Extraction Plant Slice Machine Clean Bench ‌Refrigeration Auxiliaries Valves Biologics TCM Raw Materials Food Additive Reagents and Consumables Capsule equipment Pharmaceutical water equipment Testing & Monitoring Instruments and Equipment Other Medical Aesthetics & Skincare Veterinary Pharmaceutical Intermediates Automation Software APIs for Respiratory System Drugs Bio Technology Service Antipyretic and Analgesic Preparations Glidants / Anti-caking Agents Heat Exchanger Herbal medicine Drying Equipment Air Shower Room Compressor Cylinders Fine Chemicals Crushing equipment Ultrapure Water System Other Automation & Informatization Products OEM/ODM Measuring Instruments Energy-saving and Low-carbon Equipment Other Intermediates Antiparasitic Preparations Coating Agents Storage Tanks, Containers Herbal medicine Extraction Equipment Air Purification Other Refrigeration Equipment Drive Equipment‌ Liquid preparation equipment Solution Preparation System Other Environmental Protection Equipment APIs for Hormones and Regulatory Drugs Other Natural Products Physical Testing APIs for Antiparasitic Drugs Anti-Allergic Formulations Plasticizer Evaporating Equipment TCM Cooking Equipments Cleanroom Reducers Laboratory Engineering Biopharmaceutical Equipment Membrane Module‌ APIs for Antipyretic and Analgesic Drugs Anti-Tuberculosis and Anti-Leprosy Formulations Surfactant Distillation Equipment Drop Pill Equipment Purifying Engineering VFD (Variable Frequency Drive) Other preparation equipment Distilled water machine Laboratory Solutions Vitamin Digestive System Preparations Centrifuge Screening Machine Honey Pill Machine Flooring Materials Bearing Emulsifiers Ion-exchange equipment Online Process Control Respiratory System Preparations Sterilizing Equipment TCM Deposition Equipment Spare Part‌ Other Cleaning System Stainless Steel Nervous System Preparations Filter press equipment Herbal medicine Fermentation Equipment Plastic ‌Containment System Special Active Ingredients Ointment Bases Homogenizer Equipment Other TCM Machinery Others Parts and Components APIs for Veterinary Drugs and Feed Additives Anaesthetic and Adjuvant Formulations Air Filter Suppository Bases Other Active Pharmaceutical Ingredients Blood System Formulations Cleanroom Consumables‌ Glass lining equipment Film-forming Agents Urinary and Reproductive System Formulations Other API Machinery and Equipment Filter Paper Release Modifiers Immunomodulatory Formulations Filter Paper Board smotic Pressure Regulators / Tonicity Adjusting Agents Water, Electrolyte, and Acid-Base Balance Regulating Formulations Ph Control Agents Nozzle, Tank Cleaning Machine Vitamin, Mineral, and Amino Acid Formulations Antioxidants / Antioxidant Synergists Fluid Equipment Enzyme and Other Biochemical Formulations Antimicrobial Preservatives (Preservatives) Tonic and Nutritional Formulations Complexing Agents (Chelating Agents / Inclusion Compounds) Hormonal Formulations Dermatological Preparations Other Preparations Co-solvents ENT Preparations Penetration Enhancers (Transdermal) Freeze-drying Protective Agents Refrigerants / Cryogens Capsule Fragrances Adsorbents Pressure-sensitive Adhesives (PSA) Stiffening Agents Carriers for Dry Powder Inhalers (DPI Carriers) Other Excipients
Pipes and Pipe Fittings Vacuum Equipment Air Compressor Compressor Other Fluid Equipment Prefillable Syringes Filters Filter Presstem Filtration System Filter Bag Filter Mesh Filter Cloth Filter Membrane Other Filtration Equipment Sanitary Pressure Vessel‌ Hyaluronic Acid Collagen Botulinum Toxin Peptide Other Injection Raw Materials and Ingredients Ceramide Ectoin Niacinamide Asiaticoside Ergothioneine Chitosan Other Active Ingredients Chiral Intermediates Advanced Intermediates Microfiltration Ultrafiltration Auxiliary Equipment Separation equipment Metered Dose Inhalers Dry Powder Inhalers Penicillin Hormones Central Nervous System Drugs Reagents for Biopharmaceuticals Drug Target Discovery and Validation Plant Extracts Animal Extracts Synthesis/Screening Process Development/Optimisation/Scale-Up Production Drug Registration and Submission Services Ointment Filling-sealing Machine、Vacuum Mixer Eye Drug Machinery Soft Gelatin Capsule Machinery Tablet Press Pneumatic Cracker Granulator Labelers, Label Printers Bag Packaging Machine Thermostatic / Heating / Drying Equipment Chromatography Particle Size / Particle / Powder Analysis Instruments Tabletop Glass bottles & Vials Fermentation Products Prophylactic Biological Products Mixing Tank/Blender Bioreactor Intravenous Infusion Set Assembly Equipment(Pen Assembly Equipment) PCR Recombinant Collagen Alkaloids Veterinary API Regulated Fine Chemicals Peptides Balances / Weighing Scales Online Gas Chromatography Cephalosporins Anesthetics Immunology Reagents Drug Development Technologies Pharmaceutical Chemistry Formulation Design Regulatory and Compliance Consulting Syrup Machinery Injection Medicine Machinery Hard Capsule Filling Machine Coating Machine Medicine Material Grinding Machine Lettering machine Box Packaging Machine Mass Spectrometry Laboratory Bench Aluminum Foil Rheometers / Viscometers ‌Chemical Reagents Cleaning & Disinfection Equipment Granulator Emulsifier Biological Fermentation System Injection Molding Equipment Exosome Phospholipids Prostaglandins Veterinary Biologics Chemical Reagents Therapeutic Biological Products Biochemical Reagents Antibodies Natural Pigments Animal Lipids Enzyme Preparations Flowmeters Online Particle Size Analyzer Tetracycline Amino Acids and Derivatives Process Optimization and Testing Nucleic Acids and Derivatives Pre-Clinical Research Chemical/Biological API Manufacturing Powder Filling Machine Oral Liquid Machinery Low Temperature Pulverizer Strapping machine Paper Film Packaging Machine Thermal Analyzers Spectrometers Other Measurement and Metrology Instruments Storage Cabinets Plastic Bottles Other Industrial Process Control and Online Analytical Instruments Certification Feed Additives Diagnostic Biological Products Pulverizer Coating Machine Capsule Filling Machine Other Mixing Equipment Cell Engineering Equipment Pre-filled Syringe Production Equipment Purification Equipment Electrophoresis/Gel Imaging/UV Detection Regenerative Materials Other Fine Chemicals Cell Biology Reagents Biological Consumables Feed Additives Soft Mist Inhaler Plant Polysaccharides Animal Proteins Microbial Polysaccharides Aminoglycoside Enzymes Molecular Biology Reagents Clinical Trials Intermediate Synthesis and Production Market and Business Strategy Consulting Suppository Drug Machinery Powder Injection Machinery Pharmaceutical Milling Machinery Printing Device Blister Packaging Machine Environmental Test Chambers Moisture Analyzer Air Discharge Equipment Rubber Stopper Tablet Press Other Tablet Equipment Capsule Production Line Isolator Synthesis/Reaction Equipment Microbial Detection Instrument Composite Biomaterials Animal Breeding Auxiliary Products Packaging Testing Equipment Laboratory Glassware and General Consumables Preclinical Research Services Nebulizer Essential Oils Animal Polysaccharides Bioactive Functional Ingredients Macrolides Microbial / Fermentation Reagents Proteins Other Technology Services Biotechnology Services Formulation Development and Manufacturing Other Services Medicine Film Drug Machinery Infusion Medicine Machinery(中文站有输液剂机械的三级分类) Pharmaceutical Machine Milling Instruction Booklet Folding Machine Fan Chromatography Consumables and Accessories Other Physical Properties Testing Instruments Gasket Sample Preparation / Digestion Equipment X-ray Structure Analysis Safety Cabinet Counting Machine (Tablet) Other Capsule Filling Equipment Disposable Biotechnology Equipment Vacuum Packaging Machine Laboratory Low-temperature Storage Other Innovative Materials Other Veterinary Conveying equipment Natural Spices Bile Acids and Active Ingredients Sulfonamides Other Specialized Reagents Computational Chemistry and AI-Assisted Drug Design Clinical Trial Drug Manufacturing Aerosol Drug Machinery Super Micro Mill Bottle Conveyer Bundling Packaging Machine Mixing/Dispersion Equipment Other Laboratory Complete & Ancillary Equipment Trays Other Laboratory Consumable Other Preparation Machinery for Solid Medcine ‌Centrifugal Separation System Automatic Packaging Machine Other Analytical Instrument Chip System/Accessories Cytokines Counting Machine Cartridge Vial Medicinal Herbs Bee Products Chloramphenicols Testing Other Pharmaceutical Manufacturing Outsourcing Medicine Filling Machine Disk Type Bottle Straightening Machine Lidding Materials Other Crushing Equipment Ultrafiltration/Microfiltration System Horizontal Pillow Packaging Machine Cartoning Machine Auto-injector Transfection/Cell Fusion Track & Trace Gas Generators / Gas Handling Equipment Blood Products TCM Ingredients & Slices Animal Medicinal Materials Lincomycin Microbial Products Bottle Washer Vial Sealing Machine Liquid Handling Equipment Hoses and Fittings Other Biopharmaceutical Equipment Vertical Packaging Machine Casing Machine Microplate Reader/Enzyme Labeling Instrument Analysis and Validation Serialization System Pen Injector Other Anti-Infective Drug Other Pharmaceutical R&D Outsourcing Conveyer For Medicine Material Spray Pump Other Injectable Equipment Aluminum Foil Packaging Machine Coding Machine Cell Analysis Automated Assembly Other Laboratory General Equipment Packaging Bag Valve Freeze Dryer Granule packaging machine Other Drug Delivery Device Accessories Biological Microscope/In Vivo Imaging Other Antibiotics Cap Screwing Machine Nasal Drug Delivery Devices / Nasal Spray Pumps Printing Services‌ Liquid Packaging Machine Laboratory Automation Screw Capping Machine Lamp Inspection Machine Ophthalmic Drug Delivery Devices / Eye Drop Delivery Systems Labelling Powder Packaging Machine Synthesizer Heat Shrink Packaging Machine Metal Detector Insulin Pens / Blood Glucose Management Devices Security Taggants & Markings Filter Cartridge‌ Tablet Packaging Machine Animal Experiment Instrument Injection & blow molding machines Batching system Self-Injection Systems / Safety Protection Devices Incubator Equipment Printed Drugs Packaging Box filling & sealing machine Palletizing equipment CIP cleaning system Topical / Gynecological / Intimate Drug Delivery Devices Desiccants Other Life Science Instrument Bottle Filling Line Contaners Lifting Charging Machine Others Inhalant Packaging BFS Bottlepack Machine Weighting Equipment Blister Packaging Machine Pharmaceutical Paper Other Pharmaceutical Outer Packaging Equipment Packaging bag valve Container Sealing Machine Glass Tube Multi-functional Bottle Packaging Machine Medical Aesthetic Freeze-Dried Powder Vials Sachets Cartoner Packing line Primary Packaging Other Pharmaceutical Inner Packaging Equipment Aluminum Caps & Aluminum-Plastic Combination Caps Sterile Bags / Breathing Bags / Sterilization Bags Medical Device Packaging / Bioconsumables Packaging Dispensing Bottles Blister Packaging Pharmaceutical Plastic Films / Composite Film Bags Accessories Ampuls Other Packaging Materials
ELA-32 (human)
ELA-32 (human)
ELA-32 (human)
ELA-32 (human)

ELA-32 (human)

Category:
Other Specialized Reagents
CAS NO:
1680205-79-1
Standard:
ChP,
Price Range:
Get Quote
Main Sales Markets:
Central/South America
Send inquiry

Basic Info

CAS Number
1680205-79-1
Pharmacopoeia
ChP
Grade
Pharmaceutical Grade
Is Manufacturer
YES
Packaging & Delivery
Minimum Order Quantity
1mg
Delivery Cycle
2-3 weeks

Product Description

Product Name:ELA-32 (human)

Synonyms:ELA 32 (human);ELA32 (human);QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP(Disulfide bridge: 17-22) 

CAS No.:1680205-79-1

Catalog No.:GT-P409

Sequence:H-Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro-OH(Disulfide bridge: 17-22)

Molecular Formula:C170H289N63O39S4

Molecular Weight:3967.82

 

Key Specification:

Appearance: White powder
Purity(HPLC): ≥98.0%
Single Impurity(HPLC): ≤1.0%
Acetate Content(HPLC): 5.0%~12.0%
Water Content (Karl Fischer): ≤10.0%

Package: 500mg,1g, 5g, 10g, 20g, 50g, 100g, 200g, 500g

 

Description:

ELA-32 (human) is a receptor agonist peptide with a disulfide bond structure and contains 32 amino acids in its sequence. ELA-32 (human) has a strong affinity and high efficiency. It can activate transcription channels to promote protein self-renewal. It can also stimulate angiogenesis in cells and promote appetite.

 

Other services:

Hangzhou Gutuo Biotechnology Co., Ltd. Customized peptide synthesis business:

Custom peptide, peptide drug clinical peptide, order books, beauty peptide, peptide, polypeptide, detecting peptide, peptide reagents, antigenic peptides, starch, aldehyde peptide, cyclic peptide and disulfide bond bypass peptide, a peptide membranes and all kinds of antibacterial peptides, directories, peptide, phosphorylated peptide, peptide, coupling PEG BSA and KLH antigen peptide, all kinds of acid modified peptides, a variety of amine compounds modified peptides, all kinds of fluorescence labeling peptides, parity.Development and transfer of peptide and peptide technology.

MG, G, KG packaging, from R & D customization to enterprise scale production are able to provide, specific need to consult or order, if you need other peptide synthesis for the synthesis of amino acid derivatives, welcome to call, write to Gutuo Biology, we can help you with customized synthesis.

 

Statement:

Sales of the products of the company belongs to the raw materials, only for related qualification enterprise or unit sales, our company provide products only for scientific research, laboratory, not personal selling, more can not be eaten, product efficacy and potential application of agencies involved are from the published literature, not assessed by state food and drug administration, for reference only.No factual evidence.

Quantity is different, the region is different, the product demand is different the price will be different, please kiss must carefully ask clear.